Antibodies

View as table Download

Rabbit Polyclonal Antibody against ATG5

Applications Electron Microscopy, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0]

Goat Anti-PRKAA2 Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence CPLDALNTTKP, from the internal region of the protein sequence according to NP_006243.2.

Rabbit Polyclonal Anti-GABARAP

Applications WB
Reactivities Human, Insect, Cow, Dog, Mouse, Pig, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL

Goat Polyclonal Anti-ATG4C Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen C- terminus of NP_116241.2; NP_835739.1 (EDEKKQLKRFSTEE)