USD 224.00
USD 447.00
In Stock
TUBB2A mouse monoclonal antibody,clone OTI3E6
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
TUBB2A mouse monoclonal antibody,clone OTI3E6
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TUBB2A mouse monoclonal antibody,clone OTI3E6
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
Purified TUBB2A mouse monoclonal antibody, clone OTI3B7 (formerly 3B7)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TUBB2A mouse monoclonal antibody, clone OTI3B7 (formerly 3B7)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
5 Days
TUBB2A mouse monoclonal antibody,clone 3E6, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
5 Days
TUBB2A mouse monoclonal antibody,clone 3E6, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 224.00
USD 447.00
In Stock
TUBB2A mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TUBB2A mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
Purified TUBB2A mouse monoclonal antibody, clone OTI3B7 (formerly 3B7), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
Purified TUBB2A mouse monoclonal antibody, clone OTI3B7 (formerly 3B7), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
5 Days
TUBB2A mouse monoclonal antibody,clone 1H3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
5 Days
TUBB2A mouse monoclonal antibody,clone 1H3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-TUBB2A Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the N terminal of human TUBB2A. Synthetic peptide located within the following region: MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV |
Rabbit Polyclonal Anti-TUBB2A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the middle region of human TUBB2A. Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC |
TUBB2A mouse monoclonal antibody,clone OTI3E6
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |