Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) TUBB2A mouse monoclonal antibody,clone OTI3E6

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Purified TUBB2A mouse monoclonal antibody, clone OTI3B7 (formerly 3B7)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TUBB2A mouse monoclonal antibody, clone OTI3B7 (formerly 3B7)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TUBB2A mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TUBB2A mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Purified TUBB2A mouse monoclonal antibody, clone OTI3B7 (formerly 3B7), Biotinylated

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Rabbit Polyclonal Anti-TUBB2A Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the N terminal of human TUBB2A. Synthetic peptide located within the following region: MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV

Rabbit Polyclonal Anti-TUBB2A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the middle region of human TUBB2A. Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC