Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
Conjugation | Unconjugated |
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
Conjugation | Unconjugated |
Rat monoclonal anti-TUBA1A(alpha Tubulin ) antibody, clone YL1/2, Loading control
Applications | ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mammalian, Mouse, Rat, Yeast |
Conjugation | Unconjugated |
TUBA1A mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) TUBA1A mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Goat Polyclonal Anti-TUBA4A Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 400 aa to the C-terminus of human alpha tubulin produced in E. coli. |
Rabbit Polyclonal Anti-TUBA4A Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE |
Goat Polyclonal Anti-TUBA4A Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 400 aa to the C-terminus of human alpha tubulin produced in E. coli. |
USD 509.00
2 Weeks
TUBA1A mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Biotin |
USD 509.00
2 Weeks
TUBA1A mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | HRP |
Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)
Applications | IF, IHC, WB |
Reactivities | Human, Drosophila, Rat, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A |
Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat, Chimpanzee, Bovine, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 227 and 440 of alpha Tubulin 1A (Uniprot ID#Q71U36) |
Rabbit polyclonal Tubulin a antibody
Applications | IF, IHC, WB |
Reactivities | Mouse, Rat, Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Tubulin α. |
TUBA1A mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-alpha-Tubulin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | alpha-Tubulin antibody was raised against an 18 amino acid peptide near the carboxy terminus of human alpha-Tubulin |
Rabbit Polyclonal Anti-TUBA3C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL |