Antibodies

Jump to Filters
View as table Download
OR1J4 (C-term) Rabbit Polyclonal Antibody
AP53023PU-N

USD 580.00

2 Weeks

OR1J4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 275-303 amino acids from the C-terminal region of human OR1J4
OR1J4 Rabbit Polyclonal Antibody
TA337479

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR1J4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR1J4 antibody is: synthetic peptide directed towards the C-terminal region of Human OR1J4. Synthetic peptide located within the following region: ALSTCGSHLSVVSLYYGTIIGLYFLPSSSASSDKDVIASVMYTVITPLLN