Antibodies

Jump to Filters
View as table Download
OR13J1 (C-term) Rabbit Polyclonal Antibody
AP53019PU-N

USD 580.00

2 Weeks

OR13J1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen conjugated synthetic peptide between 244-272 amino acids from the C-terminal region of human OR13J1
OR13J1 Rabbit Polyclonal Antibody
TA332316

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR13J1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR13J1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR13J1. Synthetic peptide located within the following region: ILRVPSAARCCKAFSTCLAHLAVVLLFYGTIIFMYLKPKSKEAHISDEVF