OR13J1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | conjugated synthetic peptide between 244-272 amino acids from the C-terminal region of human OR13J1 |
OR13J1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | conjugated synthetic peptide between 244-272 amino acids from the C-terminal region of human OR13J1 |
Rabbit Polyclonal Anti-OR13J1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR13J1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR13J1. Synthetic peptide located within the following region: ILRVPSAARCCKAFSTCLAHLAVVLLFYGTIIFMYLKPKSKEAHISDEVF |