GGPS1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GGPS1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GGPS1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
GGPS1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GGPS1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GGPS1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-GGPS1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GGPS1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GGPS1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
GGPS1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GGPS1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
Anti-GGPS1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-GGPS1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-GGPS1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GGPS1 antibody: synthetic peptide directed towards the middle region of human GGPS1. Synthetic peptide located within the following region: LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ |
GGPS1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GGPS1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 173-202 amino acids from the Central region of human GGPS1 |