USD 490.00
2 Weeks
IL13 receptor alpha 1 (IL13RA1) (Extracell. Dom.) mouse monoclonal antibody, clone GM1E7, Purified
Applications | ELISA, FC, IF |
Reactivities | Human |
Conjugation | Unconjugated |
USD 490.00
2 Weeks
IL13 receptor alpha 1 (IL13RA1) (Extracell. Dom.) mouse monoclonal antibody, clone GM1E7, Purified
Applications | ELISA, FC, IF |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-IL13RA1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 25-363 amino acids of Human Interleukin 13 receptor, alpha 1 |
IL13 receptor alpha 1 (IL13RA1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IL13RA1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL13RA1 antibody is: synthetic peptide directed towards the N-terminal region of IL13RA1. Synthetic peptide located within the following region: VSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVP |
Rabbit polyclonal IL-13R/CD213a1 (Tyr405) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-13R/CD213a1 around the phosphorylation site of tyrosine 405 (D-I-YP-E-K). |
Modifications | Phospho-specific |