Antibodies

View as table Download

Anti-PFKFB4 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PFKFB4 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal Anti-PFKFB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PFKFB4 antibody: synthetic peptide directed towards the N terminal of human PFKFB4. Synthetic peptide located within the following region: MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR

Anti-PFKFB4 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated