AGAP1 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AGAP1 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AGAP1 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
AGAP1 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
AGAP1 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit polyclonal antibody to CENTG2 (centaurin, gamma 2)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 795 and 857 of AGAP1 (Uniprot ID#Q9UPQ3) |
AGAP1 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-AGAP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AGAP1 antibody is: synthetic peptide directed towards the middle region of Human AGAP1. Synthetic peptide located within the following region: NTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQG |
AGAP1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AGAP1 |