Antibodies

Jump to Filters
View as table Download
AGAP1 Mouse Monoclonal Antibody [Clone ID: OTI4E8]
TA504204

USD 447.00

In Stock

AGAP1 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
AGAP1 Mouse Monoclonal Antibody [Clone ID: OTI4E8]
CF504204

USD 600.00

4 Weeks

Carrier-free (BSA/glycerol-free) AGAP1 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
AGAP1 Rabbit Polyclonal Antibody
TA308588

USD 625.00

5 Days

Rabbit polyclonal antibody to CENTG2 (centaurin, gamma 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 795 and 857 of AGAP1 (Uniprot ID#Q9UPQ3)
AGAP1 Mouse Monoclonal Antibody [Clone ID: OTI4E8]
TA504204S

USD 200.00

In Stock

AGAP1 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
AGAP1 Rabbit Polyclonal Antibody
TA343187

USD 539.00

5 Days

Rabbit Polyclonal Anti-AGAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGAP1 antibody is: synthetic peptide directed towards the middle region of Human AGAP1. Synthetic peptide located within the following region: NTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQG
AGAP1 Rabbit Polyclonal Antibody
TA361637

USD 539.00

5 Days

AGAP1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human AGAP1