Antibodies

Jump to Filters
View as table Download
GNB2 Rabbit Polyclonal Antibody
TA590202

USD 482.00

In Stock

Rabbit Polyclonal GNB2 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
GNB2 Rabbit Polyclonal Antibody
TA346599

USD 539.00

5 Days

Rabbit Polyclonal Anti-GNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNB2 antibody: synthetic peptide directed towards the middle region of human GNB2. Synthetic peptide located within the following region: CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR