Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

46 - 57 of 57 results

Page 4 of 4

(reset)

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3C9]

TA501223S

USD 200.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Rat, Mouse
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5C9]

TA501224S

USD 200.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Rat, Mouse
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5A2]

TA501225S

USD 200.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Rat, Mouse
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3E2]

TA501222S

USD 200.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A8]

TA501218AM

USD 509.00

2 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A8]

TA501218BM

USD 509.00

2 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

TA501217S

USD 200.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1C5]

TA501216S

USD 200.00

2 Days

ACAT2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications	FC, IF, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1G6]

TA501220S

USD 200.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAT2 Rabbit Polyclonal Antibody

TA331169

USD 485.00

5 Days

Rabbit Polyclonal Anti-ACAT2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

1 / 2

2 / 2

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A8]

TA501218S

USD 200.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACAT2 Rabbit Polyclonal Antibody

TA310033

USD 285.00

3 Weeks

Rabbit anti-ACAT2 polyclonal antibody

Applications	WB
Reactivities	Human, Rat, Sheep, Pig, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide derived from Human ACAT 2

46 - 57 of 57 results

Page 4 of 4