Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

31 - 45 of 45 results

Page 3 of 3

(reset)

Epsin 2 (EPN2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E4]

TA504302BM

USD 509.00

2 Weeks

EPN2 (Epsin 2) mouse monoclonal antibody, clone OTI1E4 (formerly 1E4), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Epsin 2 (EPN2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H3]

TA504295AM

USD 509.00

2 Weeks

EPN2 (Epsin 2) mouse monoclonal antibody, clone OTI1H3 (formerly 1H3), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Epsin 2 (EPN2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]

TA504295BM

USD 509.00

2 Weeks

EPN2 (Epsin 2) mouse monoclonal antibody, clone OTI1H3 (formerly 1H3), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Epsin 2 (EPN2) Mouse Monoclonal Antibody [Clone ID: OTI1G3]

TA504296S

USD 200.00

2 Days

EPN2 (Epsin 2) mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Epsin 2 (EPN2) Mouse Monoclonal Antibody [Clone ID: OTI1B4]

TA504299S

USD 200.00

2 Days

EPN2 (Epsin 2) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Epsin 2 (EPN2) Mouse Monoclonal Antibody [Clone ID: OTI1F1]

TA504298S

USD 200.00

2 Days

EPN2 (Epsin 2) mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Epsin 2 (EPN2) Mouse Monoclonal Antibody [Clone ID: OTI1C5]

TA504300S

USD 200.00

2 Days

EPN2 (Epsin 2) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Epsin 2 (EPN2) Mouse Monoclonal Antibody [Clone ID: OTI1F5]

TA504301S

USD 200.00

2 Days

EPN2 (Epsin 2) mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Epsin 2 (EPN2) Mouse Monoclonal Antibody [Clone ID: OTI1E4]

TA504302S

USD 200.00

2 Days

EPN2 (Epsin 2) mouse monoclonal antibody, clone OTI1E4 (formerly 1E4)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Epsin 2 (EPN2) Mouse Monoclonal Antibody [Clone ID: OTI1H3]

TA504295S

USD 200.00

2 Days

EPN2 (Epsin 2) mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Epsin 2 (EPN2) Rabbit Polyclonal Antibody

AP01400PU-N

USD 445.00

3 Weeks

Epsin 2 (EPN2) rabbit polyclonal antibody, Aff - Purified

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

Epsin 2 (EPN2) Rabbit Polyclonal Antibody

TA315199

USD 380.00

4 Weeks

Rabbit polyclonal anti-EPN2 antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human EPN2.

Epsin 2 (EPN2) Rabbit Polyclonal Antibody

TA329768

USD 539.00

5 Days

Rabbit polyclonal Anti-EPN2 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-EPN2 antibody: synthetic peptide directed towards the middle region of human EPN2. Synthetic peptide located within the following region: SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM

Epsin 2 (EPN2) Rabbit Polyclonal Antibody

TA329769

USD 539.00

5 Days

Rabbit polyclonal Anti-EPN2 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-EPN2 antibody: synthetic peptide directed towards the middle region of human EPN2. Synthetic peptide located within the following region: DPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLN

Epsin 2 (EPN2) Rabbit Polyclonal Antibody

TA347737

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-EPN2 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-EPN2 Antibody: A synthesized peptide derived from human EPN2

31 - 45 of 45 results

Page 3 of 3