Antibodies

View as table Download

RFC3 mouse monoclonal antibody,clone OTI2E5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-RFC3 Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human RFC3

Carrier-free (BSA/glycerol-free) RFC3 mouse monoclonal antibody,clone OTI2E5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RFC3 mouse monoclonal antibody,clone OTI2E5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-RFC3 Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human RFC3

RFC3 (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the center region of human RFC3.

Rabbit Polyclonal Anti-RFC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFC3 antibody: synthetic peptide directed towards the C terminal of human RFC3. Synthetic peptide located within the following region: IIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKF

Rabbit Polyclonal Anti-RFC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFC3 antibody: synthetic peptide directed towards the N terminal of human RFC3. Synthetic peptide located within the following region: YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL

RFC3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human RFC3 (NP_002906.1).
Modifications Unmodified

RFC3 mouse monoclonal antibody,clone OTI4A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated