Antibodies

Jump to Filters
View as table Download
Calreticulin 3 (CALR3) Rabbit Polyclonal Antibody
TA344272

USD 539.00

5 Days

Rabbit Polyclonal Anti-CALR3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CALR3 antibody: synthetic peptide directed towards the N terminal of human CALR3. Synthetic peptide located within the following region: MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK
Calreticulin 3 (CALR3) Mouse Monoclonal Antibody [Clone ID: OTI1D2]
TA505837S

USD 200.00

2 Days

CALR3 (Calreticulin 3) mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications WB
Reactivities Human
Conjugation Unconjugated
Calreticulin 3 (CALR3) Mouse Monoclonal Antibody [Clone ID: OTI1D1]
TA505873S

USD 200.00

2 Days

CALR3 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Calreticulin 3 (CALR3) Mouse Monoclonal Antibody [Clone ID: OTI1G4]
TA505888S

USD 200.00

In Stock

CALR3 (Calreticulin 3) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications WB
Reactivities Human
Conjugation Unconjugated