AGPAT5 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
AGPAT5 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
AGPAT5 mouse monoclonal antibody, clone OTI5F4 (formerly 5F4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
AGPAT5 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
AGPAT5 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AGPAT5 mouse monoclonal antibody, clone OTI5F4 (formerly 5F4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AGPAT5 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
AGPAT5 mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
AGPAT5 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
AGPAT5 mouse monoclonal antibody, clone OTI5F4 (formerly 5F4), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
AGPAT5 mouse monoclonal antibody, clone OTI5F4 (formerly 5F4), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
AGPAT5 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
AGPAT5 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
AGPAT5 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-AGPAT5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AGPAT5. |
Rabbit Polyclonal Anti-AGPAT5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AGPAT5 antibody: synthetic peptide directed towards the N terminal of human AGPAT5. Synthetic peptide located within the following region: RLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYTGVQILLYGDLPKNKE |