Rabbit anti-PDE1B Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDE1B |
Rabbit anti-PDE1B Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDE1B |
PDE1B (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 466-495 amino acids from the C-terminal region of human PDE1B |
Rabbit Polyclonal Anti-PDE1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDE1B antibody: synthetic peptide directed towards the middle region of human PDE1B. Synthetic peptide located within the following region: VKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNL |
PDE1B Rabbit monoclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDE1B mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |