Germany
Japan
United Kingdom
China
Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody,clone OTI5A11
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody, clone OTI5A7
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
MAK mouse monoclonal antibody, clone OTI4H4 (formerly 4H4), Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
MAK mouse monoclonal antibody, clone OTI4H4 (formerly 4H4), HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
MAK mouse monoclonal antibody, clone OTI5F1 (formerly 5F1), Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
MAK mouse monoclonal antibody, clone OTI5F1 (formerly 5F1), HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
MAK mouse monoclonal antibody,clone OTI5A11, Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
MAK mouse monoclonal antibody,clone OTI5A11, HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
MAK mouse monoclonal antibody,clone OTI5A7, Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
MAK mouse monoclonal antibody,clone OTI5A7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
Rabbit Polyclonal Anti-MAK Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAK antibody: synthetic peptide directed towards the C terminal of human MAK. Synthetic peptide located within the following region: WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR |
Rabbit polyclonal MAK (Ab-159) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human MAK. |
MAK Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 370-435 of human MAK (NP_005897.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MAK
Reactivities
- Human