Carrier-free (BSA/glycerol-free) HMBS mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HMBS mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HMBS mouse monoclonal antibody, clone OTI5B11 (formerly 5B11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HMBS mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HMBS mouse monoclonal antibody,clone 2F4, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HMBS mouse monoclonal antibody,clone 2F4, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HMBS mouse monoclonal antibody,clone 5B11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HMBS mouse monoclonal antibody,clone 5B11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HMBS mouse monoclonal antibody,clone 3E2, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HMBS mouse monoclonal antibody,clone 3E2, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HMBS mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-HMBS Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HMBS |
Rabbit Polyclonal Anti-HMBS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HMBS antibody: synthetic peptide directed towards the N terminal of human HMBS. Synthetic peptide located within the following region: MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA |
Rabbit Polyclonal Anti-HMBS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HMBS antibody: synthetic peptide directed towards the middle region of human HMBS. Synthetic peptide located within the following region: SSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQR |
HMBS mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HMBS mouse monoclonal antibody, clone OTI5B11 (formerly 5B11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |