Antibodies

View as table Download

Anti-H6PD mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-H6PD mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-H6PD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H6PD antibody: synthetic peptide directed towards the N terminal of human H6PD. Synthetic peptide located within the following region: HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW

H6PD mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated