H6PD mouse monoclonal antibody, clone OTI3H5 (formerly 3H5), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
H6PD mouse monoclonal antibody, clone OTI3H5 (formerly 3H5), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
H6PD mouse monoclonal antibody, clone OTI3H5 (formerly 3H5), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-H6PD mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-H6PD mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-H6PD Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H6PD antibody: synthetic peptide directed towards the N terminal of human H6PD. Synthetic peptide located within the following region: HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW |
H6PD mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |