Antibodies

Jump to Filters
View as table Download
ADH7 Rabbit Polyclonal Antibody
TA346215

USD 539.00

5 Days

Rabbit Polyclonal Anti-Adh7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Adh7 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Adh7. Synthetic peptide located within the following region: LTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTL
ADH7 Rabbit Polyclonal Antibody
TA313318

USD 380.00

4 Weeks

Rabbit polyclonal anti-ADH7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADH7.
ADH7 Mouse Monoclonal Antibody [Clone ID: OTI2C3]
TA504831S

USD 200.00

2 Days

ADH7 mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated