Antibodies

Jump to Filters
View as table Download
Antithrombin III (SERPINC1) Rabbit Polyclonal Antibody
TA346039

USD 539.00

5 Days

Rabbit Polyclonal Anti-Serpinc1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Serpinc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV
MASP2 Rabbit Polyclonal Antibody
TA346117

USD 539.00

5 Days

Rabbit Polyclonal Anti-Masp2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Masp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT
Prothrombin (F2) Rabbit Polyclonal Antibody
TA347556

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-THRB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB Antibody: A synthesized peptide derived from human THRB
Antithrombin III (SERPINC1) Rabbit Polyclonal Antibody
TA354930

USD 425.00

5 Days

Rabbit anti SERPINC1/AT3(Antithrombin 3) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the intra domain 160-175aa of human AT3 protein. This sequence is identical to human, mouse, rat, dog, bovine and chicken.
C1S Mouse Monoclonal Antibody [Clone ID: OTI4D9]
TA504079S

USD 200.00

2 Days

C1S mouse monoclonal antibody, clone OTI4D9 (formerly 4D9)

Applications FC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Factor XIIIa (F13A1) Mouse Monoclonal Antibody [Clone ID: OTI1C9]
TA800337S

USD 200.00

2 Days

F13A1 (Factor XIIIa) mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Factor XIIIa (F13A1) Mouse Monoclonal Antibody [Clone ID: OTI4D2]
TA800338S

USD 200.00

2 Days

F13A1 (Factor XIIIa) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Factor XIIIa (F13A1) Mouse Monoclonal Antibody [Clone ID: OTI9E8]
TA800384S

USD 200.00

2 Days

F13A1 (Factor XIIIa) mouse monoclonal antibody, clone OTI9E8 (formerly 9E8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Factor XIIIa (F13A1) Mouse Monoclonal Antibody [Clone ID: OTI8E2]
TA800393S

USD 200.00

2 Days

F13A1 (Factor XIIIa) mouse monoclonal antibody, clone OTI8E2 (formerly 8E2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
C1QA Mouse Monoclonal Antibody [Clone ID: OTI6G5]
TA815681S

USD 150.00

2 Weeks

C1QA mouse monoclonal antibody,clone OTI6G5

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated