Germany
Japan
United Kingdom
China
USD 315.00
3 Weeks
Cytokeratin 19 (KRT19) (1-400) mouse monoclonal antibody, clone AT13D10, Purified
| Applications | ELISA, FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Cytokeratin 19 (KRT19) mouse monoclonal antibody, clone BA-17, Biotin
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Goat Anti-cytokeratin 19 (aa285-298) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HTEQLQMSRSEVTD, from the internal region of the protein sequence according to NP_002267.2. |
Goat Anti-cytokeratin 19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EGQEDHYNNLSASK, from the C Terminus of the protein sequence according to NP_002267.2. |
Mouse Monoclonal Cytokeratin 19 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KRT19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KRT19 antibody is: synthetic peptide directed towards the middle region of Human KRT19. Synthetic peptide located within the following region: DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR |
Rabbit Polyclonal Anti-Keratin 19 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Keratin 19 Antibody: A synthesized peptide derived from human Keratin 19 |
USD 458.00
2 Weeks
purified KRT19 mouse monoclonal capture antibody, validated for Luminex assays
| Applications | LMNX |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700050 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- CYTOKERATIN 19