Rabbit Polyclonal Anti-SLC6A8 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC6A8 |
Rabbit Polyclonal Anti-SLC6A8 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC6A8 |
Rabbit Polyclonal Anti-SLC6A8 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC6A8 antibody: synthetic peptide directed towards the N terminal of human SLC6A8. Synthetic peptide located within the following region: CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC |
Rabbit polyclonal anti-SLC6A8 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human SLC6A8. |
Rabbit Polyclonal Anti-SLC6A8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC6A8 antibody: synthetic peptide directed towards the middle region of human SLC6A8. Synthetic peptide located within the following region: VFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFF |
SLC6A8 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 539-635 of human SLC6A8 (NP_005620.1). |
Modifications | Unmodified |