SIGLEC10 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SIGLEC10 |
SIGLEC10 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SIGLEC10 |
Rabbit Polyclonal Anti-SIGLEC10 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SIGLEC10 |
SIGLEC10 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIGLEC10. |
Modifications | Unmodified |
Rabbit Polyclonal Anti-SIGLEC10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SIGLEC10 antibody: synthetic peptide directed towards the middle region of human SIGLEC10. Synthetic peptide located within the following region: CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL |