Antibodies

View as table Download

Rabbit polyclonal anti-RUFY1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RUFY1.

Rabbit Polyclonal Anti-RUFY1 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RUFY1 antibody: synthetic peptide directed towards the C terminal of human RUFY1. Synthetic peptide located within the following region: QCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLL