Antibodies

View as table Download

Rabbit Polyclonal Anti-PFKFB2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PFKFB2 Antibody: A synthesized peptide derived from human PFKFB2

Rabbit polyclonal PFKFB2 (Ab-483) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PFKFB2 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 446-505 of human PFKFB2 (NP_006203.2).
Modifications Unmodified

PFKFB2 (Y14) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 1-50 of Human PFKFB2.

Rabbit polyclonal anti-PFKFB2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human PFKFB2.

Rabbit Polyclonal Anti-PFKFB2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PFKFB2

Rabbit Polyclonal Anti-PFKFB2 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pfkfb2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRALDMQEGADQPKTQVSI

Rabbit Polyclonal Anti-PFKFB2 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pfkfb2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ

Phospho-PFKFB2-S483 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S483 of human PFKFB2 (NP_006203.2).
Modifications Phospho S483