Rabbit polyclonal Anti-PCDHA10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCDHA10 antibody: synthetic peptide directed towards the N terminal of human PCDHA10. Synthetic peptide located within the following region: ESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPV |
Rabbit polyclonal Anti-PCDHA10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCDHA10 antibody: synthetic peptide directed towards the N terminal of human PCDHA10. Synthetic peptide located within the following region: DKDKFPVLVLRKLLDREENPQLKLLLTATDGGKPEFTGSVSLLILVLDAN |
PCDHA10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human PCDHA10 (NP_114066.1). |
Germany
Japan
United Kingdom
China