Antibodies

View as table Download

Anti-EEF1G Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 276-437 amino acids of human eukaryotic translation elongation factor 1 gamma

eEF1G Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 168-437 of human eEF1G (NP_001395.1).
Modifications Unmodified

Rabbit polyclonal anti-EEF1G antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EEF1G.

Rabbit Polyclonal Anti-EEF1G Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EEF1G antibody: synthetic peptide directed towards the N terminal of human EEF1G. Synthetic peptide located within the following region: AAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF

Rabbit Polyclonal Anti-EEF1G Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EEF1G antibody: synthetic peptide directed towards the middle region of human EEF1G. Synthetic peptide located within the following region: RAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKE