Antibodies

View as table Download

DENND1B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DENND1B

Rabbit Polyclonal antibody to DENND1B (DENN/MADD domain containing 1B)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 272 of DENND1B (Uniprot ID#Q6P3S1)

DENND1B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DENND1B

DENND1B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DENND1B

Rabbit Polyclonal Anti-DENND1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DENND1B antibody: synthetic peptide directed towards the N terminal of human DENND1B. Synthetic peptide located within the following region: YKLLNTLADYLAKELENDLNETLRSLYNHPVPKANTPVNLSVNQEIFIAC

Rabbit Polyclonal Anti-DENND1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DENND1B antibody: synthetic peptide directed towards the middle region of human DENND1B. Synthetic peptide located within the following region: PVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEY

DENND1B rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DENND1B