DENND1B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DENND1B |
DENND1B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DENND1B |
Rabbit Polyclonal antibody to DENND1B (DENN/MADD domain containing 1B)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 272 of DENND1B (Uniprot ID#Q6P3S1) |
DENND1B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DENND1B |
DENND1B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DENND1B |
Rabbit Polyclonal Anti-DENND1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DENND1B antibody: synthetic peptide directed towards the N terminal of human DENND1B. Synthetic peptide located within the following region: YKLLNTLADYLAKELENDLNETLRSLYNHPVPKANTPVNLSVNQEIFIAC |
Rabbit Polyclonal Anti-DENND1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DENND1B antibody: synthetic peptide directed towards the middle region of human DENND1B. Synthetic peptide located within the following region: PVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEY |
DENND1B rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DENND1B |