KIF5B Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 650-770 of human KIF5B (NP_004512.1). |
| Modifications | Unmodified |
Goat Polyclonal Antibody against KIF5B
| Applications | IHC, WB |
| Reactivities | Human, Dog (Expected from sequence similarity: Mouse, Rat, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QPVAVRGGGGKQV, from the C Terminus of the protein sequence according to NP_004512.1. |
Rabbit Polyclonal antibody to UKHC (kinesin family member 5B)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 901 and 963 of UKHC (Uniprot ID#P33176) |
Rabbit Polyclonal Anti-KIF5B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF5B antibody: synthetic peptide directed towards the N terminal of human KIF5B. Synthetic peptide located within the following region: CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST |
Rabbit Polyclonal Anti-KIF5B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF5B antibody: synthetic peptide directed towards the C terminal of human KIF5B. Synthetic peptide located within the following region: ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE |
Germany
Japan
United Kingdom
China
