Germany
Japan
United Kingdom
China
Anti-IL18 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
TA324190 is a possible alternative to TA324189.
Antibodies
View as table Download
Goat Anti-IL18 Antibody
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NPPDNIKDTKSDI, from the internal region of the protein sequence according to NP_001553.1. |
Rabbit polyclonal Mouse IL-18 antibody
| Applications | IF |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with native 157 aa mouse IL-18 produced in E.coli. |
Rabbit Polyclonal Anti-IL18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL18 antibody: synthetic peptide directed towards the C terminal of human IL18. Synthetic peptide located within the following region: IIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- IL18
Isotypes
- IgG