Rabbit Polyclonal Anti-CD160 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CD160 |
Rabbit Polyclonal Anti-CD160 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CD160 |
CD160 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CD160 |
Rabbit Polyclonal CD160 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CD160 antibody was raised against a 17 amino acid peptide near the center of human CD160. |
Rabbit Polyclonal Anti-CD160 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD160 antibody: synthetic peptide directed towards the middle region of human CD160. Synthetic peptide located within the following region: SGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEG |
CD160 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human CD160 (NP_008984.1). |
Modifications | Unmodified |
CD160 (T45) polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 21-70 of Human CD160. |