Antibodies

View as table Download

CBWD1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CBWD1

Rabbit Polyclonal Anti-CBWD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CBWD1 antibody is: synthetic peptide directed towards the N-terminal region of Human CBWD1. Synthetic peptide located within the following region: GAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQ