CBWD1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CBWD1 |
CBWD1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CBWD1 |
Rabbit Polyclonal Anti-CBWD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CBWD1 antibody is: synthetic peptide directed towards the N-terminal region of Human CBWD1. Synthetic peptide located within the following region: GAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQ |