Antibodies

Jump to Filters
View as table Download
RNF41 Rabbit Polyclonal Antibody
TA337293

USD 539.00

5 Days

Rabbit Polyclonal Anti-RNF41 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF41 antibody: synthetic peptide directed towards the middle region of human RNF41. Synthetic peptide located within the following region: QQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETI
RNF41 Rabbit Polyclonal Antibody
TA392686

USD 325.00

3 Weeks

NRDP1 (E119) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 100-150 of Human NRDP1.