Goat Polyclonal Anti-Rab15 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab15 produced in E. coli. |
Rabbit Polyclonal Anti-RAB15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAB15 Antibody: synthetic peptide directed towards the N terminal of human RAB15. Synthetic peptide located within the following region: SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI |
Rabbit Polyclonal Anti-RAB15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAB15 Antibody: synthetic peptide directed towards the middle region of human RAB15. Synthetic peptide located within the following region: QTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEVGDATSLPGCGE |
Germany
Japan
United Kingdom
China