Antibodies

View as table Download

Rabbit Polyclonal Anti-NSMCE4A Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NSMCE4A antibody is: synthetic peptide directed towards the C-terminal region of Human NSMCE4A. Synthetic peptide located within the following region: PVIQEERAMPAQLRRMEESHQEATEKEVERILGLLQTYFREDPDTPMSFF

Rabbit Polyclonal Anti-NSMCE4A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NSMCE4A antibody is: synthetic peptide directed towards the C-terminal region of Human NSMCE4A. Synthetic peptide located within the following region: NEENEGFEHNTQVRNQGIIALSYRDWEIVKTFEISEPVITPSQRQQKPSA