Antibodies

View as table Download

Rabbit Polyclonal Anti-GUK1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GUK1

Rabbit Polyclonal Anti-GUK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GUK1 Antibody: synthetic peptide directed towards the middle region of human GUK1. Synthetic peptide located within the following region: IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI