Rat Monoclonal anti-Bcl11b Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Rat Monoclonal anti-Bcl11b Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-BCL11B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-BCL11B Antibody: synthetic peptide directed towards the middle region of human BCL11B. Synthetic peptide located within the following region: QASKLKRHMKTHMHKAGSLAGRSDDGLSAASSPEPGTSELAGEGLKAADG |
Rabbit Polyclonal Anti-BCL11B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BCL11B antibody: synthetic peptide directed towards the C terminal of human BCL11B. Synthetic peptide located within the following region: RHMKTHGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQ |