Rabbit polyclonal Collagen VI a3 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Collagen VI a3. |
Rabbit polyclonal Collagen VI a3 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Collagen VI a3. |
Rabbit polyclonal Collagen VI a2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Collagen VI a2. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Biotin
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Conjugation | Biotin |
Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Rabbit Polyclonal Anti-COL6A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COL6A1 antibody: synthetic peptide directed towards the middle region of human COL6A1. Synthetic peptide located within the following region: ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ |
Rabbit Polyclonal Anti-COL6A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COL6A2 antibody: synthetic peptide directed towards the C terminal of human COL6A2. Synthetic peptide located within the following region: ARRFVEQVARRLTLARRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTAI |