Antibodies

Jump to Filters
View as table Download
RPS4Y1 Rabbit Polyclonal Antibody
TA314477

USD 380.00

In Stock

Rabbit polyclonal anti-RPS4Y1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human RPS4Y1.
RPS12 Rabbit Polyclonal Antibody
TA314489

USD 380.00

In Stock

Rabbit polyclonal anti-RPS12 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human RPS12.
RPS20 Rabbit Polyclonal Antibody
TA314494

USD 380.00

In Stock

Rabbit polyclonal anti-RPS20 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPS20.
MRPL13 Rabbit Polyclonal Antibody
TA315390

USD 380.00

In Stock

Rabbit polyclonal anti-MRPL13 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MRPL13.
RPLP0 Rabbit Polyclonal Antibody
TA332762

USD 365.00

2 Weeks

Rabbit anti-RPLP0 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human RPLP0
FAU Rabbit Polyclonal Antibody
TA335022

USD 539.00

5 Days

Rabbit Polyclonal Anti-FAU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAU antibody: synthetic peptide directed towards the middle region of human FAU. Synthetic peptide located within the following region: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
RPL10 Rabbit Polyclonal Antibody
TA314457

USD 380.00

In Stock

Rabbit polyclonal 60S Ribosomal Protein L10 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 60S Ribosomal Protein L10.
RPS3 Rabbit Polyclonal Antibody
TA332545

USD 365.00

3 Weeks

Rabbit anti-RPS3 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RPS3
RPS28 Rabbit Polyclonal Antibody
TA338334

USD 539.00

5 Days

Rabbit Polyclonal Anti-RPS28 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPS28 antibody is: synthetic peptide directed towards the N-terminal region of Human RPS28. Synthetic peptide located within the following region: RTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLTLLESEREARRLR
RPL8 Rabbit Polyclonal Antibody
TA345688

USD 485.00

5 Days

Rabbit Polyclonal Anti-RPL8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL8 antibody: synthetic peptide directed towards the C terminal of human RPL8. Synthetic peptide located within the following region: KKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAM
RPL11 Rabbit Polyclonal Antibody
TA350369

USD 380.00

In Stock

Rabbit Polyclonal Anti-RPL11 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPL11
RPL3L Rabbit Polyclonal Antibody
TA314453

USD 380.00

4 Weeks

Rabbit polyclonal anti-RPL3L antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL3L.
RPL17 Rabbit Polyclonal Antibody
TA314461

USD 380.00

4 Weeks

Rabbit polyclonal anti-RPL17 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL17.
RPL34 Rabbit Polyclonal Antibody
TA314468

USD 380.00

4 Weeks

Rabbit polyclonal anti-RPL34 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL34.
RPL18 Rabbit Polyclonal Antibody
TA335159

USD 539.00

5 Days

Rabbit polyclonal Anti-RPL18 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL18 antibody: synthetic peptide directed towards the N terminal of human RPL18. Synthetic peptide located within the following region: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR