Antibodies

View as table Download

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR

Rabbit Polyclonal Anti-CNDP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CNDP1

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALDH3A2

Rabbit Polyclonal antibody to Aspartoacylase (aspartoacylase (Canavan disease))

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Pig, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 39 and 300 of Aspartoacylase (Uniprot ID#P45381)

Rabbit polyclonal antibody to KAO (amiloride binding protein 1 (amine oxidase (copper-containing)))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 179 of KAO (Uniprot ID#P19801)

Rabbit Polyclonal TYW4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4.

Anti-ALDH3A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member A1

Rabbit polyclonal HNMT Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HNMT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human HNMT.

Rabbit Polyclonal DDC Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DDC antibody was raised against a 14 amino acid peptide near the carboxy terminus of human DDC

Rabbit Polyclonal Anti-ALDH3A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the N terminal of human ALDH3A1. Synthetic peptide located within the following region: DLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYI

Rabbit Polyclonal Anti-DDC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC. Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE

Goat Polyclonal Anti-FTCD Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 50 aa to the N-terminus of human FTCD produced in E. coli.

Rabbit polyclonal anti-ALDH3B1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ALDH3B1.

Rabbit anti-ALDH2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH2

Rabbit anti-ALDH3A1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH3A1