Rabbit polyclonal GSTO1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GSTO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 126-155 amino acids from the Central region of human GSTO1. |
USD 380.00
In Stock
Rabbit Polyclonal antibody to GSTA2 (glutathione S-transferase alpha 2)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Monkey, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 196 of GSTA2 (Uniprot ID#P09210) |
Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAP3 antibody: synthetic peptide directed towards the N terminal of human LAP3. Synthetic peptide located within the following region: LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN |
Rabbit Polyclonal antibody to PGD (phosphogluconate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Chicken, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 201 of PGD (Uniprot ID#P52209) |
Rabbit polyclonal GSTP1 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GSTP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 165-192 amino acids from the C-terminal region of human GSTP1. |
Germany
Japan
United Kingdom
China
