VAMP5 mouse monoclonal antibody,clone OTI7F2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
VAMP5 mouse monoclonal antibody,clone OTI7F2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) VAMP5 mouse monoclonal antibody,clone OTI7F2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
VAMP5 mouse monoclonal antibody,clone OTI7F2, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
VAMP5 mouse monoclonal antibody,clone OTI7F2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-VAMP5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
VAMP5 mouse monoclonal antibody,clone OTI7F2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-VAMP5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VAMP5 antibody: synthetic peptide directed towards the middle region of human VAMP5. Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN |