Antibodies

Jump to Filters
View as table Download
RNF185 Rabbit Polyclonal Antibody
TA350363

USD 380.00

In Stock

Rabbit Polyclonal Anti-RNF185 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RNF185
RNF185 (Center) Rabbit Polyclonal Antibody
AP53680PU-N

USD 580.00

2 Weeks

RNF185 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Hamster, Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 91-121 amino acids from the Central region of Human RN185.
RNF185 Rabbit Polyclonal Antibody
TA330506

USD 539.00

5 Days

Rabbit Polyclonal Anti-RNF185 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF185 antibody: synthetic peptide directed towards the middle region of human RNF185. Synthetic peptide located within the following region: QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF