Antibodies

Jump to Filters
View as table Download
QSOX2 Rabbit Polyclonal Antibody
TA317240

USD 515.00

5 Days

QSOX2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gorilla, Human, Monkey, Mouse, Gibbon, Horse (Predicted: Rat, Bovine, Dog, Hamster)
Conjugation Unconjugated
Immunogen QSOX2 antibody was raised against synthetic 20 amino acid peptide from internal region of human QSOX2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Bat, Horse (100%); Rat, Bovine (95%); Dog, Hamster (90%); Panda, Opossum (85%); Turkey, Chicken (80%).
QSOX2 Rabbit Polyclonal Antibody
TA334359

USD 539.00

5 Days

Rabbit Polyclonal Anti-QSOX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-QSOX2 antibody is: synthetic peptide directed towards the middle region of Human QSOX2. Synthetic peptide located within the following region: VVKPLRAFFSSYLKSLPDVRKKSLPLPEKPHKEENSEIVVWREFDKSKLY