Antibodies

View as table Download

Rabbit polyclonal anti-ZP1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZP1.

Rabbit polyclonal Anti-ZP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZP1 antibody: synthetic peptide directed towards the middle region of human ZP1. Synthetic peptide located within the following region: TLEHWDVNKRDYIGTHLSQEQCQVASGHLPCIVRRTSKEACQQAGCCYDN

Rabbit polyclonal Anti-ZP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZP1 antibody: synthetic peptide directed towards the middle region of human ZP1. Synthetic peptide located within the following region: PVGFEDSYGQEPTLGPTDSNGNSSLRPLLWAVLLLPAVALVLGFGVFVGL