Antibodies

Download

LPAR1 (EDG2) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LPAR1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GRPR Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Dog, Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse (Predicted: Bovine)
Conjugation Unconjugated
Immunogen GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%).

Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus.

GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-NPY1R rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of Human neuropeptide Y receptor Y1

GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-DRD4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-15 amino acids of Human Dopamine receptor D4

Rabbit Polyclonal Vanilloid R1/TRPV1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the rat TRPV1 protein (between residues 1-50) [UniProt O35433]

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW

Rabbit Polyclonal S1P1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1.