Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GALNT6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GALNT6 antibody: synthetic peptide directed towards the N terminal of human GALNT6. Synthetic peptide located within the following region: MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDP |
Rabbit Polyclonal antibody to ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Chicken, Rat, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 68 and 327 of ST3GAL2 (Uniprot ID#Q16842) |
Rabbit Polyclonal Anti-GCNT3 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | GCNT3 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human GCNT3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (93%); Marmoset (80%). |
Goat Polyclonal Antibody against GCNT3 (aa 410 to 422)
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NKFDPKVDDNALQ, from the internal region (near C terminus) of the protein sequence according to NP_004742.1. |
Rabbit polyclonal anti-B4GALT5 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human B4GALT5. |
Rabbit polyclonal C1GALT1 Antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This C1GALT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 115-144 amino acids from the Central region of human C1GALT1. |
Rabbit Polyclonal Anti-C1galt1c1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C1galt1c1 Antibody is: synthetic peptide directed towards the N-terminal region of Rat C1galt1c1. Synthetic peptide located within the following region: SFQVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDT |
Rabbit Polyclonal Anti-ST3GAL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST3GAL2 antibody: synthetic peptide directed towards the C terminal of human ST3GAL2. Synthetic peptide located within the following region: ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN |
Rabbit Polyclonal Anti-GALNT9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GALNT9 antibody is: synthetic peptide directed towards the C-terminal region of Human GALNT9. Synthetic peptide located within the following region: DFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLTYGEVRNSKASA |
GALNT6 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 551-579 amino acids from the C-terminal region of human GALNT6 |
Active filters
Families
- Transmembrane
Pathways
- O-Glycan biosynthesis