Rabbit Polyclonal Anti-FOLH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FOLH1 Antibody: synthetic peptide directed towards the C terminal of human FOLH1. Synthetic peptide located within the following region: FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA |
Rabbit Polyclonal Anti-FOLH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FOLH1 Antibody is: synthetic peptide directed towards the middle region of Human FOLH1. Synthetic peptide located within the following region: FSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSV |
Germany
Japan
United Kingdom
China