Antibodies

Jump to Filters
View as table Download
LMAN2 Rabbit Polyclonal Antibody
TA341862

USD 539.00

5 Days

Rabbit Polyclonal Anti-LMAN2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LMAN2 antibody: synthetic peptide directed towards the N terminal of human LMAN2. Synthetic peptide located within the following region: SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF
LMAN2 Rabbit Polyclonal Antibody
TA341863

USD 539.00

5 Days

Rabbit Polyclonal Anti-LMAN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LMAN2 antibody: synthetic peptide directed towards the C terminal of human LMAN2. Synthetic peptide located within the following region: LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL